Protein Info for Psest_3657 in Pseudomonas stutzeri RCH2

Annotation: Spermidine/putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 54 to 281 (228 residues), 39.3 bits, see alignment E=1.2e-13 PF13416: SBP_bac_8" amino acids 54 to 298 (245 residues), 162.9 bits, see alignment E=2.1e-51 PF13343: SBP_bac_6" amino acids 121 to 306 (186 residues), 45.9 bits, see alignment E=8e-16

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 96% identity to psa:PST_0737)

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRX0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Psest_3657 Spermidine/putrescine-binding periplasmic protein (Pseudomonas stutzeri RCH2)
MSNYLKLSALALGLVCAGQATANSLTAVSFGGANKQAQVKAFYQPWEAAGHGRIVAGEYN
GEMAKVKAMVDTNSVSWNLVEVESPELSRGCDEGLFEELDPSIVGNSDDFVEGAIQPCGV
GFFVWSTVLAYNADKLKSAPASWADFWDTEKFPGKRGLRKGAKYTLEFALMADGVPVKDV
YKVLATKDGQNRAFRKLDQLKPNIQWWEAGAQPPQFLASGDVVMSSAYNGRIAAVQNESN
LQIVWSGGIYDFDSWAIPKGAKSQEQARKFIAFTVEPQQQKAYAENIAYGPANTQAVSLL
DEKRLAQMPTAPENIADQVAMDVTFWADYGEQLEQRFNAWAAR