Protein Info for Psest_0360 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 143 (134 residues), 43.1 bits, see alignment E=2.4e-15 amino acids 161 to 297 (137 residues), 36.4 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_3893)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG64 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Psest_0360 Predicted permease, DMT superfamily (Pseudomonas stutzeri RCH2)
MLATPFPRHIAVLILATLACSFAANHIAARIAFDHGTGLLLAMLCRAGVTLLALAALVFW
RRESLRLSPATWRWQILLGLLIAVQSFCIYSAVARIPVALALLVVNLSPILLALLTWALG
GPRPTRQALAIMGLILIGLVLVLDVPARLMSAEAPDGQWVAGILFSLTAAAVFAVALWVT
EHKLSNMAGSVRSMLTLLVVFGASALLGASDLIPGGLGLPNASAGWIALGCLVLLYGAAF
STLFICMPRLNIARNAPVMNMEPVAGMLLGWLVLGQLLGAMQVVGGLIVVGGVVLLAYRR