Protein Info for Psest_3655 in Pseudomonas stutzeri RCH2

Annotation: ABC-type spermidine/putrescine transport system, permease component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 262 (178 residues), 65.5 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to psa:PST_0739)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN18 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Psest_3655 ABC-type spermidine/putrescine transport system, permease component II (Pseudomonas stutzeri RCH2)
MLSPYMSPVERAWYYALRILCALVLLFLIVPVLVIVPLSFNSGSFLVYPLQGFSMRWYEA
LFSSADWMRSLKNSMLIAPAATFLAVVLGTLAAVGLTRAEFRGKALLMTILISPMVVPVV
IIGVASYLFFAPLGMGNSYLSLILVHAVLGVPFVIITVSATLQGFNYNLVRAAASLGASP
LTAFFRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQITLPRQMFSGIRENLSPT
IAAAATLLIGFSIALLLTLEWLRGRAEKLRTQQPA