Protein Info for PGA1_c36370 in Phaeobacter inhibens DSM 17395

Annotation: HTH-type transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00392: GntR" amino acids 23 to 84 (62 residues), 56 bits, see alignment E=5e-19 PF13545: HTH_Crp_2" amino acids 42 to 78 (37 residues), 35.3 bits, see alignment 1.7e-12 PF01047: MarR" amino acids 46 to 79 (34 residues), 25.5 bits, see alignment 2e-09 PF07702: UTRA" amino acids 109 to 237 (129 residues), 97.3 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: None (inferred from 74% identity to sit:TM1040_3001)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESF6 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PGA1_c36370 HTH-type transcriptional regulator, GntR family (Phaeobacter inhibens DSM 17395)
MAAVEQDTSGGRRMTERTKTGFQDVRDEVLKRIQDRVWGQGDLLPTEQDLAEEFGCARAT
VNRALRELADRGIIDRKRKSGTRVAVLPVKQAKLEITLTRQLVEDRNAIYRYALVHREEI
PAPGWLASQLQLAADTPVLHIRAMHYGDNQPFQFEDRWINIAAVPSVAEADFSVVGPNEW
LLAEVPFSTAELSFGAIAADAALAEYLACPIAAPLFQMERTTWFQAQPVTFVRMSFHPGY
QMRSRY