Protein Info for Psest_3648 in Pseudomonas stutzeri RCH2

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF02885: Glycos_trans_3N" amino acids 4 to 66 (63 residues), 80.1 bits, see alignment E=8.1e-27 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 8 to 337 (330 residues), 421.6 bits, see alignment E=1.2e-130 PF00591: Glycos_transf_3" amino acids 75 to 328 (254 residues), 331.8 bits, see alignment E=3.4e-103

Best Hits

Swiss-Prot: 97% identical to TRPD_PSEU5: Anthranilate phosphoribosyltransferase (trpD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 97% identity to psa:PST_0746)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ48 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Psest_3648 anthranilate phosphoribosyltransferase (Pseudomonas stutzeri RCH2)
MDIKEALNRIVGQLDLSTEEMQAVMRQIMTGQCTDAQVGAFLMGMRMKSETIDEIVGAVQ
VMRELAAPVRFDTDKLVDTCGTGGDGMNIFNVSTAASFVVAAAGGKVAKHGNRAVSGKSG
SADLLEAAGVFLDLTPEQVARSVDTVGVGFMFAPAHHGAMKHAAGPRRELGLRTLFNILG
PMANPAGVRHQVLGVFSKALCRPMAEVLARLGSKHVLVVHAQDGLDEISLAAPTHVAELK
DGEIREYSIQPEDFGIKSQSLIGLNVEDAQGSLALIRDALGRRQSENGQKAADMIVLNAG
AALYAADLASSLKQGVEMAHDALSTGLARDKLEELVSFTAVFKQENQK