Protein Info for PGA1_c36360 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Formiminoglutamic iminohydrolase (EC 3.5.3.13)
Rationale: Specifically important for utilizing L-Histidine. Automated validation from mutant phenotype: the predicted function (FORMIMINOGLUTAMATE-DEIMINASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: putative formiminoglutamate deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR02022: formiminoglutamate deiminase" amino acids 1 to 452 (452 residues), 570.5 bits, see alignment E=1.2e-175 PF01979: Amidohydro_1" amino acids 47 to 426 (380 residues), 97.3 bits, see alignment E=5.5e-32

Best Hits

KEGG orthology group: None (inferred from 70% identity to sit:TM1040_3003)

Predicted SEED Role

"Formiminoglutamic iminohydrolase (EC 3.5.3.13)" in subsystem Histidine Degradation (EC 3.5.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F225 at UniProt or InterPro

Protein Sequence (455 amino acids)

>PGA1_c36360 Formiminoglutamic iminohydrolase (EC 3.5.3.13) (Phaeobacter inhibens DSM 17395)
MQTIFAQHARMPQGWVTDLRLTIEAGKIATLEPGAAVQPQDHRVGALVPALANLHSHSFQ
RAMAGMTETRVSGRDSFWSWRKLMYQFVDHLTPEQYEAIAALVFMEMLEAGYASVGEFHY
VHHQPGGQPYEVLGELSHRVFAAADLTGIGLTHLPVLYTYGGAGQAPLGGGQQRFGNDVT
RYANLLSDCRTTARELLPMDARVGIAPHSLRATAPDELAEVLTLRAESPVHIHIAEQPQE
VADIGGWLGERPVQWLLNNCAVDKDWCLIHATHMTEQETHDLARSGAVAGLCPITEANLG
DGPFNGVLFQNNGGRFGVGSDSNIRISLSEELRLLEYSQRLRDLARNVMVPEEGSVGAAL
YLGAACGGAQALGRDAGRLEVGALADLMAFDTTDVTLCALRPDQFLDGLCFAADDSVVRD
VWSAGRHVVSGGRHANREQIIARYNSAVAALLSAL