Protein Info for HP15_3523 in Marinobacter adhaerens HP15

Annotation: zinc ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 80 (33 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 177 to 207 (31 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 261 (252 residues), 240.4 bits, see alignment E=1.2e-75

Best Hits

Swiss-Prot: 55% identical to ZNUB_ECOLI: High-affinity zinc uptake system membrane protein ZnuB (znuB) from Escherichia coli (strain K12)

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 87% identity to maq:Maqu_3777)

MetaCyc: 55% identical to Zn2+ ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG23 at UniProt or InterPro

Protein Sequence (270 amino acids)

>HP15_3523 zinc ABC transporter, permease protein (Marinobacter adhaerens HP15)
MPIIDAILDDFFWRALIGGLGVALVAGPLGCFVVWRRMAYFGDTLAHSALLGIALSFLIS
VPLNLGVIITCVVLAMALVLLSRTRTLATDTLLGILAHSALAIGLVTLSFMPDVRVDLTG
LLFGDLLAMSREDLLWIYGGAALIIILLAVLWQGLLMSTIHEELARVEGVAVERLRLVLM
LMFSLVIAVAMKIVGVLLITALLIIPAATARRLAHNPEIMAAMAVGFGFVAVSGGLSLSW
HLDTPAGPSVVVTAFAVFLLVYGAAGKVRT