Protein Info for PGA1_c36350 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Imidazolonepropionase (EC 3.5.2.7)
Rationale: Specifically important for utilizing L-Histidine. Automated validation from mutant phenotype: the predicted function (IMIDAZOLONEPROPIONASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: imidazolonepropionase HutI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR01224: imidazolonepropionase" amino acids 29 to 403 (375 residues), 454.2 bits, see alignment E=1.5e-140 PF01979: Amidohydro_1" amino acids 64 to 382 (319 residues), 73.7 bits, see alignment E=1.7e-24 PF07969: Amidohydro_3" amino acids 199 to 380 (182 residues), 61 bits, see alignment E=1.6e-20

Best Hits

Swiss-Prot: 75% identical to HUTI_RUEST: Imidazolonepropionase (hutI) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 75% identity to sit:TM1040_3004)

MetaCyc: 60% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DW49 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PGA1_c36350 Imidazolonepropionase (EC 3.5.2.7) (Phaeobacter inhibens DSM 17395)
MGDTDSYLICDATLATMTGSDPAYGLVPDGLIVVQNGWIRWCGSEAQLPKDYSDWPRVSM
GGRLVTPGLIDCHTHIVFGGNRAMEFEMRLNGASYEDVARAGGGIVSTVSATRTASLEDL
VQGALPRLDALIAEGATVVEVKSGYGLDRETELNMLRAARRLAVLRSVTVNTTFLGAHAT
PGEYKGRDDAYIDEVCIPALRAAHAEGLVDAVDGFCENIAFAPAQIERVFKAARELGLPV
KLHAEQLSHQGGTALSAQYGALSVDHVEYATEDDAKMMAAAGSVAVILPGAFYTIREIQA
PPIEHFRSHGVPMALATDCNPGSSPLTSLLLTMNMGCTLFRMTPEEALAGVTRNAASALG
LTDRGQISAGMRADLAVWDVETPGELAYRIGFNPLYTRIYEGNQ