Protein Info for PGA1_c36310 in Phaeobacter inhibens DSM 17395

Annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase DapD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF14805: THDPS_N_2" amino acids 5 to 71 (67 residues), 93.5 bits, see alignment E=1.1e-30 TIGR00965: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase" amino acids 6 to 274 (269 residues), 420.3 bits, see alignment E=1.7e-130 PF00132: Hexapep" amino acids 179 to 213 (35 residues), 29.4 bits, see alignment 7.1e-11 PF14602: Hexapep_2" amino acids 179 to 213 (35 residues), 44.1 bits, see alignment 2e-15

Best Hits

Swiss-Prot: 92% identical to DAPD_DINSH: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 94% identity to sit:TM1040_3009)

MetaCyc: 65% identical to tetrahydrodipicolinate succinylase (Escherichia coli K-12 substr. MG1655)
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. [EC: 2.3.1.117]

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F220 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PGA1_c36310 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase DapD (Phaeobacter inhibens DSM 17395)
MSNAQLETAIEAAWEARDTITSATTGEQRDAIEETLNALDSGKLRVAERQDSGNWHVNQW
AKKAVLLGFRIKDMEEQSGGPQGSGWWDKVDSKFKGWGEAEWKEAGFRAVPNCVVRKSAY
IAPGVVLMPSFVNLGAHVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPT
IIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAG
SMPSKNGINLYCAVIVKRVDERTRSKTGINELLRD