Protein Info for HP15_3513 in Marinobacter adhaerens HP15

Annotation: response regulator receiver domain protein (CheY)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF00072: Response_reg" amino acids 10 to 122 (113 residues), 97.4 bits, see alignment E=3.1e-32

Best Hits

Swiss-Prot: 84% identical to PILG_PSEAE: Protein PilG (pilG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02657, twitching motility two-component system response regulator PilG (inferred from 99% identity to maq:Maqu_3767)

Predicted SEED Role

"twitching motility protein PilG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG13 at UniProt or InterPro

Protein Sequence (130 amino acids)

>HP15_3513 response regulator receiver domain protein (CheY) (Marinobacter adhaerens HP15)
MDDNFENLKIMVIDDSKTIRRTAETLLKKVGCEVITATDGFDALAKIADSQPDIIFVDIM
MPRLDGYQTCALIKNNSSFKKTPVIMLSSKDGLFDKAKGRIVGSDQYLTKPFSKDELLNT
IRQYVPQAEQ