Protein Info for Psest_3637 in Pseudomonas stutzeri RCH2

Annotation: Predicted molecular chaperone distantly related to HSP70-fold metalloproteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF03702: AnmK" amino acids 3 to 363 (361 residues), 519.5 bits, see alignment E=2.5e-160

Best Hits

Swiss-Prot: 72% identical to ANMK_PSEF5: Anhydro-N-acetylmuramic acid kinase (anmK) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 79% identity to psa:PST_0756)

MetaCyc: 65% identical to anhydro-N-acetylmuramic acid kinase monomer (Pseudomonas aeruginosa PAO1)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRV2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Psest_3637 Predicted molecular chaperone distantly related to HSP70-fold metalloproteases (Pseudomonas stutzeri RCH2)
MTLYLGVMSGTSLDGLDIALIEQHTHTRLIATRFQEMPATLRQELLALCSTGADELARAA
IAEQRWATLAAETINQLLSDQQLFPQAVRAIGSHGQTVRHEPHLGFTIQIGNPALLAELT
GISVVSDFRRRDVAAGGQGAPLVPAFHESVFGDKERIRAVLNIGGFSNLSLLCHGSPTNG
FDCGPGNVLMDAWIQRHRNQAFDRNGDWAASGSVDEELLAALLSEEFFTTQGPKSTGREL
FNLSWLDKHLAEHGHLSPENIQATLLELTAKSIADSLMTTQAETQDLLVCGGGAHNVALM
RRLQALLPSCDVRSTESEGVPPDWVEAMAFAWLAHCCLERIPANRPAVTGARGDRILGAI
YPA