Protein Info for PGA1_c36240 in Phaeobacter inhibens DSM 17395

Annotation: ribosomal RNA large subunit methyltransferase N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 22 to 378 (357 residues), 401.1 bits, see alignment E=1.9e-124 PF21016: RlmN_N" amino acids 24 to 87 (64 residues), 51 bits, see alignment E=1e-17 PF04055: Radical_SAM" amino acids 131 to 309 (179 residues), 62.9 bits, see alignment E=4.5e-21

Best Hits

Swiss-Prot: 87% identical to RLMN_RUEST: Dual-specificity RNA methyltransferase RlmN (rlmN) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 87% identity to sit:TM1040_3014)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DW39 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PGA1_c36240 ribosomal RNA large subunit methyltransferase N (Phaeobacter inhibens DSM 17395)
MTANAPITQDVLTLPRKLPEGGKINLVGLTRDQLRETLIAHGTPEKQAKMRVGQIWQWIY
QWGKRDFAEMTNLAKAYRADLDEHFEIATPEVVSKQVSTDGTRKYLVRIAGGHEVEVVYI
PEEGRGTLCISSQVGCTLTCSFCHTGTQKLVRNLTAAEIVGQIMMARDDLDEWPVPGAPK
DETRLLSNIVLMGMGEPLYNFENVRDAMKIAMDPEGISLSRRRITLSTSGVVPEIARTAE
EIGCLLAVSFHATTDEVRDKLVPINKRWNIEALLEALRAYPRLTNSERITFEYVMLNGVN
DSDEDAHRLVELIKGIPAKVNLIPFNEWPGSPYTRSSNNRIHAFANIIYQAGYASPIRTP
RGEDILAACGQLKSATERARKSRKQIEAEAGLNP