Protein Info for PGA1_c36190 in Phaeobacter inhibens DSM 17395

Annotation: activator of Hsp90 ATPase 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08327: AHSA1
  • amino acids 12 to 139 (128 residues), 91.2 bits, E=3e-30

Best Hits

KEGG orthology group: None (inferred from 61% identity to sil:SPO3351)

Predicted SEED Role

"Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See I7DW31 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PGA1_c36190 activator of Hsp90 ATPase 1 family protein (Phaeobacter inhibens DSM 17395)
MTDLRLEREFPVTPERLFAWISDTEKLLQWWGPEGMTVPEHTLNFHQEGPWSTVMTNADG
DRYHVSGVVTHVRPPQSIGFTWGWHDETGARGHESHVTLTVEAVDAGARLVIDHRNLDSS
EQAAGHQKGWESTLRKLASKIQ