Protein Info for PGA1_c36120 in Phaeobacter inhibens DSM 17395

Annotation: putative glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF02798: GST_N" amino acids 3 to 71 (69 residues), 48.6 bits, see alignment E=2.1e-16 PF13417: GST_N_3" amino acids 4 to 77 (74 residues), 74.8 bits, see alignment E=1.4e-24 PF13409: GST_N_2" amino acids 10 to 73 (64 residues), 67.6 bits, see alignment E=3.1e-22 PF14497: GST_C_3" amino acids 135 to 199 (65 residues), 23.7 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 47% identical to FZLA_CAUVN: FtsZ-localized protein A (fzlA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 90% identity to sit:TM1040_2825)

Predicted SEED Role

"Glutathione S-transferase family protein" in subsystem Glutathione: Non-redox reactions

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5X8 at UniProt or InterPro

Protein Sequence (221 amino acids)

>PGA1_c36120 putative glutathione S-transferase (Phaeobacter inhibens DSM 17395)
MARLYHVPLSPFCRKVRLSLAEKRIEVELVEERYWEKEADFLRRNPAAKVPVIRLDGKLM
AESAAICEYLEETRPDPSLMPSDPEGRYEVRRLVSWFDDKFHHEVTSKLLYERVNKKVTG
QGYPDSGNVKAGARAIKYHLDYLAWLLDHRRWLAGDQMTLADFAAAAHLSSLDYISDVDW
NRSAVVKDWYAKIKSRPAFRSILADQIPGFSPPAHYADLDF