Protein Info for PGA1_c36010 in Phaeobacter inhibens DSM 17395

Annotation: arabinose 5-phosphate isomerase KdsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF01380: SIS" amino acids 43 to 172 (130 residues), 91.9 bits, see alignment E=2.9e-30 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 45 to 312 (268 residues), 301.6 bits, see alignment E=2.9e-94 PF00571: CBS" amino acids 203 to 256 (54 residues), 23 bits, see alignment 8e-09 amino acids 265 to 320 (56 residues), 34.1 bits, see alignment E=2.8e-12

Best Hits

Swiss-Prot: 48% identical to Y1546_AQUAE: Uncharacterized phosphosugar isomerase aq_1546 (aq_1546) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 80% identity to sil:SPO0082)

MetaCyc: 45% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVZ3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PGA1_c36010 arabinose 5-phosphate isomerase KdsD (Phaeobacter inhibens DSM 17395)
MSSAETFLATARQVITDEARALDALADGLDARFAEAVDLVLQAEGRVIVSGIGKSGHIGH
KIAATLASTGTPAYFVHPAEASHGDLGMLSKGDVVLAISNSGEAPELANLLSFTRRFGIP
LIGLSSRMDSTLMKEADVHLQIPALGEACGFGMVPSISTTLTLAMGDALAIALMKHRDFR
PENFRAFHPGGKLGARLSKVDDLMHDGTALPLVGADTPMSDALIEISQKGFGVAGVTGAN
GTLQGIITDGDLRRHMDGLLDKTAADVMTSSPTTIAPGSLAEEAVAIMNDRKITCLFVVD
PAGDTAQAVGLLHIHDCLRVGLG