Protein Info for Psest_0355 in Pseudomonas stutzeri RCH2

Annotation: Glycine cleavage system regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF13740: ACT_6" amino acids 3 to 66 (64 residues), 50.3 bits, see alignment E=3.7e-17 PF13291: ACT_4" amino acids 88 to 159 (72 residues), 28.5 bits, see alignment E=3.9e-10 PF01842: ACT" amino acids 91 to 159 (69 residues), 27.9 bits, see alignment E=3.3e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_3897)

Predicted SEED Role

"Glycine cleavage system transcriptional antiactivator GcvR" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG60 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Psest_0355 Glycine cleavage system regulatory protein (Pseudomonas stutzeri RCH2)
MDHLVLTVIAEDQPGLVERLAKCIADHGGNWLESRMSRMAGQFAGILRVAVPQQAHAELT
AALQGLEAQGIRVLLAHSGTEPVESWQEIQLELVGNDRPGIVRDITHLLATHGVNLESLD
TEVLPAPMSSELLFRAEVRLAVPSELSLEVLQQRLEALADDLMVELKLQPAEKP