Protein Info for HP15_3473 in Marinobacter adhaerens HP15

Annotation: type VI secretion system, VCA0110

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 544 to 561 (18 residues), see Phobius details PF05947: T6SS_TssF" amino acids 2 to 587 (586 residues), 527.4 bits, see alignment E=2.6e-162 TIGR03359: type VI secretion protein, TIGR03359 family" amino acids 3 to 590 (588 residues), 680.2 bits, see alignment E=1.7e-208

Best Hits

KEGG orthology group: K11896, type VI secretion system protein ImpG (inferred from 89% identity to maq:Maqu_3730)

Predicted SEED Role

"Protein ImpG/VasA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFG6 at UniProt or InterPro

Protein Sequence (590 amino acids)

>HP15_3473 type VI secretion system, VCA0110 (Marinobacter adhaerens HP15)
MRLNRFYRDELSFLRLQGREFADAHPQLTRFLSEQSTDPDVERLLEGFAFLTGKLREKVE
DEFPEITHSLLNMLWPNYLRPVPSCTIMRFDPQLHAISERQRVERHTEIKSRPLGDANRQ
TQCRFRTCRAVDVFPVSVAAAHAEHSREVSSVTVDLALHTDQPLSSLGMDSLRFYLGGES
HVAETLFLWLNHYLKRIDLVVGDAVYRLPASLLRPVGFGNEEALLPYPKNAYPGYRILQE
YLSFPEAFRFVDILGLGRRLPALQADEISLRFHFSRILPPDAKVREDNFQLYCTPAVNLF
THEGEPVDLNGRQTEYRISPSSRSPDHYEVFSIEQVEGWLEGRSGRGEPRIYTPFESFQH
EVERDRGRTALYYRVRARDSVRGDGFDHYMSFVRGDESECLSRQEAVSLTLTCTNRHLPS
QLAVGEICMATESTPAFAAFSNITRPTATLRPTLDGSLLWTLISNLSLNYLSMLDVDALR
TVLRVYDFRALVDRQAERVSQKRLAGITCIETAPVDRMVKGLPVRGIRSVLKLEQQAFAS
EGDLYLFGTVLSQFFALYASINAFHQLEVVNTDNQERYTWTLQQGQQPLM