Protein Info for PGA1_c35800 in Phaeobacter inhibens DSM 17395

Annotation: flagellar biosynthetic protein FliQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details PF01313: Bac_export_3" amino acids 8 to 78 (71 residues), 92.7 bits, see alignment E=5.5e-31

Best Hits

Swiss-Prot: 45% identical to FLIQ_CLOTE: Flagellar biosynthetic protein FliQ (fliQ) from Clostridium tetani (strain Massachusetts / E88)

KEGG orthology group: K02420, flagellar biosynthetic protein FliQ (inferred from 72% identity to sil:SPO0179)

Predicted SEED Role

"Flagellar biosynthesis protein FliQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F427 at UniProt or InterPro

Protein Sequence (90 amino acids)

>PGA1_c35800 flagellar biosynthetic protein FliQ (Phaeobacter inhibens DSM 17395)
MMSEGLFYDTLRQALWASVMMSTPILLVALVVGLAIGLFQALTSVQEMTLTFVPKLTAIL
VVFWMTMGFMTQTLVAFFDGHVVPLISGGL