Protein Info for HP15_3467 in Marinobacter adhaerens HP15

Annotation: type VI secretion ATPase, ClpV1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 877 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 866 (854 residues), 1164.6 bits, see alignment E=0 PF00004: AAA" amino acids 221 to 352 (132 residues), 35.7 bits, see alignment E=5.1e-12 amino acids 621 to 739 (119 residues), 26.6 bits, see alignment E=3.3e-09 PF17871: AAA_lid_9" amino acids 363 to 452 (90 residues), 99.3 bits, see alignment E=4.9e-32 PF07724: AAA_2" amino acids 615 to 776 (162 residues), 171.9 bits, see alignment E=5.6e-54 PF07728: AAA_5" amino acids 620 to 741 (122 residues), 42.6 bits, see alignment E=2.8e-14 PF10431: ClpB_D2-small" amino acids 782 to 856 (75 residues), 43 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 90% identity to maq:Maqu_3724)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFG0 at UniProt or InterPro

Protein Sequence (877 amino acids)

>HP15_3467 type VI secretion ATPase, ClpV1 family (Marinobacter adhaerens HP15)
MIRVELPALIGRLNDMSRQALEASAALCISRQGAEITPAHLLFKLLETPFSDVRQILEHT
GLEHQQLQPLVGDSLNGESQSAEPYPSFSPLLVELMQDAWLLASTELGHTELRSGAVFLA
LLMNADRYLMPRVAKAMVDINREQLRKQFDRFTEGSAERLEPSEQEPGQPVASVDLDPLK
RYATDFTRLAREDKLDPVVCRDAEIDQMIDILCRRRKNNPIVVGDAGVGKSAVVEGLALR
IVNGDVPDRLKSVELWTLDMGALQAGASVKGEFEKRLKGVIEAVKGSATPIILFIDEAHT
LIGAGNSEGGSDAANLLKPALARGELRTIAATTWREYKKYFEKDPALSRRFQPVALDEPT
PGEAVHILRGLRTVYEKAHQVLIADSALKAAAEMSARYLAGRQLPDKAIDVLDTACARVS
LNLSAPPRRLSRVRSELYQLAMEQNLLCREHTLGQTVDAERERELEQRVAGITVESAALE
QRWSDQRELVARLVEIREKLLTGESQAEANTPELTDGITEERPDLKSEAAAIEQELTELQ
ADEPLVHTRVDARQVAEVIADWTGIPVNRMTTDELEKITHLPAYLQEHIKGQDTAIDCLH
QHLLTARADLRRPGRPMGAFLLVGPSGVGKTETVVQLAELLYGGRQFLTTINMSEYQEKH
TVSRLIGSPPGYVGFGEGGILTEAIRQKPYSVVLLDEVEKAHPEVLNLFYQAFDKGELAD
GEGRLIDCKNVVFFLTSNLGYQTIVNHAESPASLDEALYPELASFFKPALLARMEVVPYL
PLGEETLNRIVGDKLQRLADQIKARYHTEVELEEGLIEAIRNRATRSENGARMLESIIEG
ELLPPVSLALLEKLAAREPVKKVTLAVEEHRFVGTVA