Protein Info for PGA1_c35770 in Phaeobacter inhibens DSM 17395

Annotation: putative flagella basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03170: flagella basal body P-ring formation protein FlgA
  • amino acids 15 to 138 (124 residues), 110.8 bits, E=2.5e-36
• PF13144: ChapFlgA
  • amino acids 19 to 137 (119 residues), 84.9 bits, E=4.8e-28
• PF08666: SAF
  • amino acids 20 to 75 (56 residues), 30 bits, E=6.1e-11

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 65% identity to sit:TM1040_2959)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

See I7F1T3 at UniProt or InterPro

Protein Sequence (138 amino acids)

>PGA1_c35770 putative flagella basal body P-ring formation protein FlgA (Phaeobacter inhibens DSM 17395)
MKRILAIVMLFCAQPAWADILVPVRTIRAKEIVTAEDLVLKQAEVLGAISDPSLVIGQEA
RVALYAGRPMRPGDVGPPAIVERNDLVTIRFKRGGLTILAEGRSLGRGADGEAIRVMNLS
SRTTISGRIAADGTVEVN