Protein Info for PGA1_c35710 in Phaeobacter inhibens DSM 17395

Annotation: flagellar biosynthetic protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 282 to 314 (33 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 13 to 695 (683 residues), 834.4 bits, see alignment E=3.3e-255 PF00771: FHIPEP" amino acids 23 to 684 (662 residues), 733.3 bits, see alignment E=1.5e-224

Best Hits

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 82% identity to sit:TM1040_2953)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVW3 at UniProt or InterPro

Protein Sequence (697 amino acids)

>PGA1_c35710 flagellar biosynthetic protein FlhA (Phaeobacter inhibens DSM 17395)
MPNIDMQKLFSPTVLLAIALMAIIVMMILPMPAWVLDIGLATSFGLAILIFTITLFIERP
LDFSSFPTILLASLMLRLSLNVSSTKLIIGQGHTGTDAAGGVIEGFAQFVMGGSVFLGLV
VFGVLLIVNFMVITKGAARMAEVGARFALDGMPGKQLAIDSDMSAGAIDHATARDRRETE
QRETTFFGSLDGASKFVKGDAIAGLLITLLNLIMGLIMGVLVHGMPVVSAFETYAILTVG
DGLVSQIPSVIISIAAALLLARGGATGSTDIALADQLGKHPAALATVAILMALFALVPGL
PFIPFMAGAAVLGYTAYKMSKNLKDREEAEMEEQIEEVMEPKENRALGDILDLDDLHLEF
APDLVSMVLDAGTGLDARIANMRTHVATTFGLILPEIRLTDEPELMTGTYVIKIQGVEQV
RGILHPEMVLALMPDNHDALPPGTDVTEPVYGAPARWISSKAQEDAALSGATIVTAPEIL
ATHLLEVIKQNFPRLLSLKSLRRLLNEMTELTDEFRAEANRKLLDELVPDKVPIDTLHTV
LRLLLEERVSIRNMPLILESIAEARLHTPQPEIICEHVRQRLGFQLVGEMKREDGTIPLI
QLAPEWEETFSTYQIDAQGGAVDIALPPEQFNRLAEGLSERLNTTTEQGVFAAVVTSTRR
RRYLRTILKSRGILNPVLSFEEIGLEARPALVGMVPA