Protein Info for PGA1_c35670 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 67% identity to sit:TM1040_2950)

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1S3 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PGA1_c35670 Uncharacterized conserved protein (Phaeobacter inhibens DSM 17395)
MAKAAKTKAAPAKPKKAKRIKRTRSGALMMLALLLMGSAIVRLGLEAGPAIAREVANLQD
ESILKDEPKGTLNGQSMPSSAELQNMLAAFQEREAALSAREAEIEDRMKALEIADDAIEQ
KLVALEQAEEELKSTLALADGATEADLTRLTSVYEQMKPKESSALFEEMDPAFAAGFLAR
MRPEAAAGIMAGLSPQAAYTISVVLAGRNGSVPKE