Protein Info for Psest_3573 in Pseudomonas stutzeri RCH2

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 3 to 291 (289 residues), 248.8 bits, see alignment E=6.2e-78 PF01370: Epimerase" amino acids 40 to 200 (161 residues), 26.1 bits, see alignment E=5.4e-10

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 76% identity to pmy:Pmen_3875)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.133

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQK2 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Psest_3573 dTDP-4-dehydrorhamnose reductase (Pseudomonas stutzeri RCH2)
MRMRLMLLGGGNALGQALIRLGAEEDIGFLAPRPPAQGWDAASLTQLLDDNRPDVVVNLA
YYYDWFQSGQPNEPALAAQERAVERLAELCQHHDFVLLQPSSYRVFDGARTTAYSEKDEV
APLDARGHALWRIEQSVRSLCPRHVLLRFGWLLDDSRDGVLGRVLQRLEQSEPILLADDR
RGNPTPVDDAARVILAVLKQLDCQAPLWGTYHYGGHEASTPLLVAQALLGEAGKYRDVTS
ANLTAVAHADCSDAAAEPQHGVLACKKIFTTFGVKPRAWRTGLPSLLERYYRHG