Protein Info for PGA1_c35610 in Phaeobacter inhibens DSM 17395

Annotation: flagellar biosynthetic protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 45 to 74 (30 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details PF00813: FliP" amino acids 48 to 241 (194 residues), 229.9 bits, see alignment E=1.3e-72 TIGR01103: flagellar biosynthetic protein FliP" amino acids 48 to 245 (198 residues), 238.3 bits, see alignment E=3.2e-75

Best Hits

Swiss-Prot: 48% identical to FLIP_RHIME: Flagellar biosynthetic protein FliP (fliP) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 78% identity to sit:TM1040_2944)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVV3 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PGA1_c35610 flagellar biosynthetic protein FliP (Phaeobacter inhibens DSM 17395)
MTRTALLAAVLAAILAVGLPDVVSAQDLSLSLGDGQSISARSIQLILLITVLSLAPGLLI
MITCFPFLVTVLSILRQAIGLQQAPPNMLMISLALFLTYFVMEPVFTEAWTTGINPLIEE
QLDVETGLERALQPFRVFMAARLDPDTFYAIADLRPSTAGIDPTADAPLSTLVSSFMLSE
IARAFQVGFLVFLPFLVIDLVVAAVLMSMGMMMVPPAVVSMPFKLAFFVVADGWSLIASA
LVRSYFP