Protein Info for PGA1_c35600 in Phaeobacter inhibens DSM 17395

Annotation: flagellar P-ring protein FlgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02119: FlgI" amino acids 24 to 366 (343 residues), 448.9 bits, see alignment E=5.2e-139

Best Hits

Swiss-Prot: 81% identical to FLGI_RUEPO: Flagellar P-ring protein (flgI) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 89% identity to sit:TM1040_2942)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F409 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PGA1_c35600 flagellar P-ring protein FlgI (Phaeobacter inhibens DSM 17395)
MMRFIRILLAVMLLPAMAQANAIRLKDLVEFDGVRGNDLVGYGLVVGLNGTGDGLRNSPF
TEEIMSNILERLGVNVTGEQFRPKNVAAVFVTATLPPFARVGGTVDVTVSAIGDSKSLLG
GTLVMTPLNAADGQIYAVAQGTILAGGAVAEGEGASVTQGVPTAGVIPSGARVEREIDFD
LSSLTSMRLALREPDFTTAGRIERAINAEFGRNVALMQDSGTVEVDVQRTNTRSTAHAVG
RIENILVEPQRKARVVVDQRSGTIVMGSDVRISRVAVAQGNLTLRIEETPLVVQPNPFAD
GETVIVPRTGAAIEEEEGIQLAEVPETTSLSEVVAGLNALGVSPRDMIDILKSLKAAGAL
HAEFVVR