Protein Info for HP15_35 in Marinobacter adhaerens HP15

Annotation: thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF22691: Thiolase_C_1" amino acids 267 to 388 (122 residues), 100.3 bits, see alignment E=4.1e-33

Best Hits

KEGG orthology group: None (inferred from 76% identity to bxe:Bxe_C0581)

Predicted SEED Role

"3-ketoacyl-CoA thiolase (EC 2.3.1.16)" in subsystem Biotin biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle or n-Phenylalkanoic acid degradation (EC 2.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16

Use Curated BLAST to search for 2.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI94 at UniProt or InterPro

Protein Sequence (396 amino acids)

>HP15_35 thiolase (Marinobacter adhaerens HP15)
MFDRLYEKDVAITGIGQSEVARPSDLSGMQLTVDACLEAISDAGLQREDIDGIACWPGDN
NNGNSFSPVGPSALQNALGLKVNWFGGGYEGPGPLAGIINGAMAIATGLCRHVLVFRTIT
ESSARRVNKGASALSNKTQGRDNSFAWQWYTPFNVLSASNLVAMYAQRHFHDYGTKPEQM
AQIALNARRNAQLNPKAIYRTPMTMDDYMSSRVISSPLRLYDCDVHCDASTAIILSRKDI
ARDLPNSPIHIEAIGSALHQPWSWDQVSLTEGAAFDVGKMMWSRTDLKPSDVGSAQLYDG
FSILTMIWLEALNLCPKGESGSFIEGGHRIALDGALPINTNGGQLSGGRTHGLGYVHEAC
LQLWGKAGERQTAEHDVAVTAAGGGPLGGSLLLVKD