Protein Info for Psest_3555 in Pseudomonas stutzeri RCH2

Annotation: Predicted methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 57 to 74 (18 residues), see Phobius details PF10294: Methyltransf_16" amino acids 62 to 168 (107 residues), 40 bits, see alignment E=1.4e-13 PF05175: MTS" amino acids 72 to 149 (78 residues), 36.9 bits, see alignment E=1.2e-12 PF13489: Methyltransf_23" amino acids 79 to 164 (86 residues), 29.7 bits, see alignment E=2e-10 PF06325: PrmA" amino acids 81 to 153 (73 residues), 59.4 bits, see alignment E=1.8e-19 PF13847: Methyltransf_31" amino acids 82 to 158 (77 residues), 27.3 bits, see alignment E=1.1e-09 PF13649: Methyltransf_25" amino acids 85 to 152 (68 residues), 33.1 bits, see alignment E=3.1e-11 PF08241: Methyltransf_11" amino acids 86 to 153 (68 residues), 23.4 bits, see alignment E=3.1e-08

Best Hits

KEGG orthology group: None (inferred from 85% identity to pmy:Pmen_3860)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRW1 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Psest_3555 Predicted methyltransferase (Pseudomonas stutzeri RCH2)
MTAPAPLQAALNELLGDARLVVEPLPDTDLRLWLIDAANMDRAFSAEETRRILEDPPYWS
FCWASGLVLARWLAERPEWVRGKRVLDFGAGSGVAAIAAAKAGAAEVVACDLDPLALAAC
QANAALNEVELRYSQDFFGEADRYDLIIVADVLYDRANLPLLDHFLSRGREALVADSRVR
DFAHPLYRRLDVLDACTWPDLAEPAEFRQVSLYHATR