Protein Info for HP15_3429 in Marinobacter adhaerens HP15

Annotation: two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 PF01627: Hpt" amino acids 16 to 104 (89 residues), 32.8 bits, see alignment E=1e-11 PF00072: Response_reg" amino acids 278 to 387 (110 residues), 67.4 bits, see alignment E=1.8e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 403 to 561 (159 residues), 147.4 bits, see alignment E=1.7e-47 PF00990: GGDEF" amino acids 404 to 558 (155 residues), 140 bits, see alignment E=9.2e-45

Best Hits

Predicted SEED Role

"Probable two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFC2 at UniProt or InterPro

Protein Sequence (567 amino acids)

>HP15_3429 two-component response regulator (Marinobacter adhaerens HP15)
MALQSDNDVSEKLKVLREKFLTRARSDIRELSGYAEQTRSGTLSAEGLIRCYQSLHRLAG
SAGTFGLPRLGEQARLIEKQLKSQAEALGETSEAQRQSVEVSDGFADSIDALASLIEESS
ENLSSAESGNLTSPDQNRFEGSHGMQIRILLVDDDAGGQVASLATELGRYGFICQFVDQR
DETALEGIFSGITGASSILCRDSAMPVVMQHARKQENEGSRRRPPVVVIGANDSFDNEYR
IAKAGASAFFSAPVSVPELAERVELLAIERSSGVNGRVLIVEDDAELAEHYCLVLSAAGI
EAKSLTDPRRLMAELYSFQPDIVLMDVQIGDYSGVTLARLIRFESRWLSLPIIYLSSEDD
RDDQLEALSKGADEFLVKPVSDDYLVRSARIRCYRARQLSDLMNRDSLTGLLKHSLIKQE
LEKELARCRRFGHLSSVAMIDLDYFKQVNDTWGHRYGDIVIRALANLLRNRLRETDMIGR
YGGEEFMVVLPDCSVQAAADLLKSIGESFSELVFAVGEKNFQVTLSAGIAGVNEFPSGAE
ALEAADQALYQCKHEGRNGVAIYSANK