Protein Info for PGA1_c35390 in Phaeobacter inhibens DSM 17395

Annotation: photosynthetic apparatus regulatory protein RegA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 87 to 105 (19 residues), see Phobius details PF00072: Response_reg" amino acids 16 to 124 (109 residues), 79.4 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 83% identical to REGA_RHOS4: Photosynthetic apparatus regulatory protein RegA (regA) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K15012, two-component system, response regulator RegA (inferred from 89% identity to sil:SPO3865)

Predicted SEED Role

"Dna binding response regulator PrrA (RegA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3Z1 at UniProt or InterPro

Protein Sequence (184 amino acids)

>PGA1_c35390 photosynthetic apparatus regulatory protein RegA (Phaeobacter inhibens DSM 17395)
MGEAAMQEIGPDKTLLLVDDDEPFLRRLAKAMEKRGFEVETAGSVAAGSAIATARPPAFA
VVDLRLEDGNGLDVVEILRERRPDSRVVVLTGYGAIATAVAAVKIGATDYLSKPADASDI
MNALLANEEELPPPPENPMSADRVRWEHIQRVYELCDRNVSETARRLNMHRRTLQRILAK
RSPK