Protein Info for PGA1_c35370 in Phaeobacter inhibens DSM 17395

Annotation: sensor histidine kinase RegB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 106 to 122 (17 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details PF25323: 6TM_PilS" amino acids 26 to 146 (121 residues), 32.2 bits, see alignment E=1.3e-11 PF00512: HisKA" amino acids 214 to 268 (55 residues), 35.8 bits, see alignment 1e-12 PF02518: HATPase_c" amino acids 323 to 442 (120 residues), 60.8 bits, see alignment E=2.4e-20

Best Hits

Swiss-Prot: 62% identical to REGB_RHOS4: Sensor histidine kinase RegB (regB) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 76% identity to sil:SPO3867)

Predicted SEED Role

"FIG001393: Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ES37 at UniProt or InterPro

Protein Sequence (465 amino acids)

>PGA1_c35370 sensor histidine kinase RegB (Phaeobacter inhibens DSM 17395)
MSATNIDLLSGQERSHWIRLRTLILLRWVAIVGQVSAITVAQQLYNLQLELVLCYIAIGV
SVLGNLIAIILFPQNKRLSEFENFLMVLFDLLQLNFLLYLTGGLNNPFALLVLGPVTISA
SMMRLRSTLIIGATAIILVTLLAEFHLPLRTPQGFVLRVPDIFVFGNWTAIVIAVLFIGA
YSYRISAEIRSMSDALAATQMALSREQKLTDLGGVVAAAAHELGTPLATIKLASAELIDE
LDDRPDLREDAALIREQADRCRDILRSMGRAGKDDLHLRQAPLSTVINEAAEPHMYRGKT
ILFEEAPESDGDPQHPTILRQPEIIHGLRNLVQNAVDFARSTVWIDASWNDETITLRISD
DGRGYPSHLLGRIGDPFVRRRRSDSDRRQRPEYEGMGLGLFIAKTLLERSGAQLTFANGS
DPNQTLTRDPARRGALVQVSWPRSKIDALTGENAVPIGENKRIEI