Protein Info for Psest_3548 in Pseudomonas stutzeri RCH2
Annotation: transcription antitermination factor NusB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to NUSB_PSEU5: Transcription antitermination protein NusB (nusB) from Pseudomonas stutzeri (strain A1501)
KEGG orthology group: K03625, N utilization substance protein B (inferred from 96% identity to psa:PST_0839)Predicted SEED Role
"Transcription termination protein NusB" in subsystem Transcription factors bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GQH8 at UniProt or InterPro
Protein Sequence (161 amino acids)
>Psest_3548 transcription antitermination factor NusB (Pseudomonas stutzeri RCH2) MSLNHDDSQDAPQPKAKGKIATRRVARSLAMQALYQWHMAGQSLNEIEAQFRVDNDFSGV DGSYFHELLTGVARSKSEVDGAIAPNLDRPLDELDPVELAILRLSTYELMQRIDVPYRVV INEGIELAKVYGATDGHKFVNGVLDKLAPTLRSAEVRNHKR