Protein Info for PGA1_c35340 in Phaeobacter inhibens DSM 17395

Annotation: putative phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF01636: APH" amino acids 23 to 242 (220 residues), 99.6 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: K07102, (no description) (inferred from 57% identity to sit:TM1040_2843)

Predicted SEED Role

"COG3178: Predicted phosphotransferase related to Ser/Thr protein kinases" in subsystem YjeE

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3Y7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PGA1_c35340 putative phosphotransferase (Phaeobacter inhibens DSM 17395)
MTDRQSLISTFLTDTPWHNWTRAPLAGDASNRRYERLCDADGATVVLMDAPPDQGEDVAP
FVAIANYLRDQGLSAPQILAEDHDNGFLVIEDLGDALFARVMRDDPAQERPLYEAATDVL
VALHEAPMPELEPLGPRLMAELSSLAFAKYRDVIREEPSPEHVARFTDQFEDILRRTIKG
DVVLVQRDYHAENLIWLPERNGVARVGLLDFQAARAGHRAYDLVSLLQDARRDVPAVIEM
QMMERYIAATDVDEGSFRAAYTVLGVQRNMRILGVFARLGRDYGKPHYVDLIPRVWDHFH
RGLDHPAMAPLAEFLHQEMPAPTPEVLNRLRG