Protein Info for PGA1_c35300 in Phaeobacter inhibens DSM 17395

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 3 to 104 (102 residues), 119.5 bits, E=1.5e-38
• TIGR01068: thioredoxin
  • amino acids 7 to 105 (99 residues), 123.6 bits, E=1.6e-40
• PF13098: Thioredoxin_2
  • amino acids 14 to 104 (91 residues), 37.3 bits, E=7.6e-13
• PF08534: Redoxin
  • amino acids 19 to 84 (66 residues), 27.7 bits, E=5.4e-10
• PF00578: AhpC-TSA
  • amino acids 20 to 69 (50 residues), 28.2 bits, E=4e-10

Best Hits

Swiss-Prot: 73% identical to THIO_RHOSH: Thioredoxin (trxA) from Rhodobacter sphaeroides

KEGG orthology group: K03671, thioredoxin 1 (inferred from 93% identity to sit:TM1040_2847)

MetaCyc: 47% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (6/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See I7DVS6 at UniProt or InterPro

Protein Sequence (106 amino acids)

>PGA1_c35300 thioredoxin TrxA (Phaeobacter inhibens DSM 17395)
MSTVAVTDATFDAEVKNSEVPVVVDFWAEWCGPCKQIGPALEELAAEYGDKVKIAKVDVD
SNPNAASAMGVRGIPALFIFKNGEVVSNRSGAAPKAALQSWIDESI