Protein Info for PGA1_c35190 in Phaeobacter inhibens DSM 17395

Annotation: putative protein FxsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details PF04186: FxsA" amino acids 5 to 112 (108 residues), 123.1 bits, see alignment E=2.9e-40

Best Hits

KEGG orthology group: K07113, UPF0716 protein FxsA (inferred from 72% identity to sil:SPO3887)

Predicted SEED Role

"FxsA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3X6 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PGA1_c35190 putative protein FxsA (Phaeobacter inhibens DSM 17395)
MYLFLAFLMVPIIEIALFIQVGGAIGLWPTLAIVVLTAVLGTWLVRTQGRLALGQLRSSF
EQLNDPTEPLAHGAMILVAGALLLTPGFFTDAVGFALLVPQIRIAVYRYLRSKVTVARFQ
MGPGSMHGRSYPGDNSPKPQGDVIDADYEDVSNDRPRKGPSGWVDGQG