Protein Info for Psest_0347 in Pseudomonas stutzeri RCH2

Updated annotation (from data): large component of pyruvate/D-alanine transporter (actP-like)
Rationale: Important for utilization of D-alanine and pyruvate, along with Psest_0346.
Original annotation: probable sodium:solute symporter, VC_2705 subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 393 to 420 (28 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details amino acids 465 to 487 (23 residues), see Phobius details amino acids 498 to 522 (25 residues), see Phobius details amino acids 540 to 559 (20 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 8 to 580 (573 residues), 829.8 bits, see alignment E=4.6e-254 PF00474: SSF" amino acids 33 to 294 (262 residues), 124.7 bits, see alignment E=2.4e-40 amino acids 371 to 505 (135 residues), 64.5 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 96% identity to psa:PST_3902)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDY6 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Psest_0347 large component of pyruvate/D-alanine transporter (actP-like) (Pseudomonas stutzeri RCH2)
MSQYWINMLFVGASFLLYIGIAVWARAGSTKEFYVAGGGVHPVTNGMATAADWMSAASFI
SMAGLIASGGYATSVYLMGWTGGYVLLAMLLAPYLRKFGKFTVPDFIGDRFYSRGARLTA
VVCLILISVTYVIGQMAGAGVAFSRFLEVSNSAGIWIAAAIVFAYAVFGGMKGITYTQVA
QYIVLIIAYTIPAVFIAMQLTGNPIPMFGMFGTHVDSGVPLLDKLDQVVTDLGFAAYTAD
VDNKLNMFLFTLSLMIGTAGLPHVIIRFFTVPKVADARWSAGWTLVFIALLYLTAPAVAS
MARLNLVNTIYPEGPQAEAIRYEDRPEWVQTWERTGLIKWEDKNADGRVQMYNDANAKFT
PTATERGWNGNELTVNNDIIVLANPEIANLPGWVIGLIAAGAIAAALSTAAGLLLAISSA
ISHDLIKTLINPKISEKNEMLAARLSMTAAILLATWLGLNPPGFAAQVVALAFGLAAASL
FPALMMGIFSKRVNSKGAVAGMLVGVISTAVYIFLYLGWFFIPGTASIPNTPDQWWMGIS
PQAFGAVGAMLNFAVAYAVSMATEAPPQEIQDLVESVRTPKGAGVALDH