Protein Info for PGA1_c35110 in Phaeobacter inhibens DSM 17395

Annotation: tRNA modification GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF10396: TrmE_N" amino acids 3 to 117 (115 residues), 109.4 bits, see alignment E=3.3e-35 TIGR00450: tRNA modification GTPase TrmE" amino acids 9 to 430 (422 residues), 276.9 bits, see alignment E=3.6e-86 PF12631: MnmE_helical" amino acids 120 to 427 (308 residues), 157.9 bits, see alignment E=1.1e-49 TIGR00231: small GTP-binding protein domain" amino acids 214 to 299 (86 residues), 61.1 bits, see alignment E=1.1e-20 PF02421: FeoB_N" amino acids 215 to 271 (57 residues), 33.4 bits, see alignment 8.2e-12 PF01926: MMR_HSR1" amino acids 215 to 306 (92 residues), 80.1 bits, see alignment E=3.4e-26

Best Hits

Swiss-Prot: 68% identical to MNME_RUEST: tRNA modification GTPase MnmE (mnmE) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 68% identity to sit:TM1040_2864)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1M0 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PGA1_c35110 tRNA modification GTPase MnmE (Phaeobacter inhibens DSM 17395)
MDTIFALASAQGKAGVSVIRLSGPKAISTASVISGGDLPRPGRVLRVLSDCSGARIDEAL
LLTFTGPNSFTGEDTVEFQVHGSTSVVSAMLDLLGQFEDVRLSDPGEFTRRALENGKLDL
SQVEALADLIDAETEAQRVQAQAVLAGGLADLAERWRKDLIRAASLIEVTIDFADEDVPV
DVTKEVKELLAGVTADLEPQIAGVKMAERIRSGFEVAIIGAPNVGKSTLLNALAGREAAI
TSEYAGTTRDVIEVRMDLAGLPVTLLDTAGLRETDDHVEGIGIKMAKERAEKADLRVFLT
EDRTAIDIDISEDDIVVAPKADLVGDGVPQKAVSGKTGQGIDMLIADITKVLRNRAGKVG
IATRARHRETMKTAYDRLQSAQDVLRYGPEFYDVAAEDMRSAIRSLEMLVGRVGVENLLD
EIFSSFCLGK