Protein Info for HP15_3400 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator, ArsR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 5 to 126 (122 residues), 73.9 bits, E=1.7e-24
• PF01022: HTH_5
  • amino acids 154 to 199 (46 residues), 47.2 bits, 1.7e-16

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 46% identity to pmy:Pmen_1519)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (1/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (2/6 steps found)
• arsenic detoxification (yeast) (3/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See E4PF93 at UniProt or InterPro

Protein Sequence (254 amino acids)

>HP15_3400 transcriptional regulator, ArsR family protein (Marinobacter adhaerens HP15)
MKRRVLFVCTANSARSLMAEALLRDMAGDRFEVASAGTEPTRPHPIALQVLEEAGISTQG
LHSKQLADLKEQYWDYVITLCEKASSECGTVCQPAQQIAWDFADPVPANRHSTFALTLKE
IKERIALFAMVHEKKTGPKPASYDPVTVFKAMADDLRLAALLLIRSQEQLCVCELTEAFE
APQPKVSRHLATLRDAGLLATERRGQWIYYSLSPGIPQWLARVLDETASHNEQLIESPLA
RLLAMADRPAVQCL