Protein Info for Psest_3522 in Pseudomonas stutzeri RCH2

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 6 to 195 (190 residues), 188.4 bits, see alignment E=1.5e-59 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 6 to 255 (250 residues), 350.2 bits, see alignment E=2.9e-109 PF08659: KR" amino acids 7 to 157 (151 residues), 47 bits, see alignment E=4.5e-16 PF13561: adh_short_C2" amino acids 14 to 253 (240 residues), 180.3 bits, see alignment E=6.9e-57

Best Hits

Swiss-Prot: 69% identical to BDHA_CUPNH: D-beta-hydroxybutyrate dehydrogenase (hbdH1) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 99% identity to psa:PST_0861)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPV9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Psest_3522 3-hydroxybutyrate dehydrogenase (Pseudomonas stutzeri RCH2)
MNLTGKTALVTGSTSGIGLGIALKLAEAGADLILNGFGDASAALAEVGRHGRKVGHHGAD
VSDPAQIAELFAYAERDFGGVDILVNNAGIQHVAPVEEFPVERWDAIIAINLSSAFHTTR
LALPGMRQRGWGRIINIASVHGLVGSEQKAAYVAAKHGLVGLTKVVALETATTPITCNAI
CPGWVLTPLVQQQIDERARESGDEQQARHDLLAEKQPSLDFVTPAQLGAMALFLCSEAGD
QVRGAAWNMDGGWAAR