Protein Info for PGA1_c35100 in Phaeobacter inhibens DSM 17395

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 6 to 613 (608 residues), 798.9 bits, see alignment E=1.4e-244 PF07992: Pyr_redox_2" amino acids 6 to 156 (151 residues), 29.9 bits, see alignment E=1.2e-10 PF01134: GIDA" amino acids 7 to 396 (390 residues), 540.2 bits, see alignment E=9.7e-166 PF12831: FAD_oxidored" amino acids 7 to 177 (171 residues), 40.8 bits, see alignment E=5.7e-14 PF21680: GIDA_C_1st" amino acids 459 to 550 (92 residues), 63.8 bits, see alignment E=6.4e-21 PF13932: SAM_GIDA_C" amino acids 552 to 619 (68 residues), 60.2 bits, see alignment E=5e-20

Best Hits

Swiss-Prot: 74% identical to MNMG_RUEST: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 74% identity to sit:TM1040_2865)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVQ7 at UniProt or InterPro

Protein Sequence (624 amino acids)

>PGA1_c35100 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (Phaeobacter inhibens DSM 17395)
MKHPNYDVVVVGGGHAGTEAAHAAARMGVKTALVTLTKDGIGVMSCNPAIGGLGKGHLVR
EIDALDGVMARVADKAGIQFRLLNRRKGPAVQGPRAQSDRKIYRREMLAEIEAQPNLDIV
TGEVVDFLMKGDKIRGVRLADESEITSHAVILTSGTFLRGVIHIGDVSKPGGRMGDKPSV
RLAERLDSFDLQLGRLKTGTPPRLDGRTIAWEKLEGQPGDDDPTFFSFLTTSVSASQVVC
GITHTNTHTHDIIRDNLERSAMYGGHIDGVGPRYCPSIEDKVVRFSDKTSHQIFLEPEGV
DDHTVYPNGISTSLPLDVQEHYVRSVVGLEDAVILQPGYAIEYDYVDPRALGLDLALKSC
QGLYLAGQINGTTGYEEAAAQGLVAGLNAARYSKEMEPVTFSRSDSYIGVMVDDLTTNGV
TEPYRMFTSRAEFRLSLRADNADQRLTGIGSNLGCVGEVRRELFSRKMEKLEEVRARMDT
RQFTPKEINEAGIAVNQDGNRRTATDVLAFPDVAFEDILRLLPELETCEDSIRRQIERDA
LYANYIIRQKREIEALKRDEGYRIPSDFSYDFEGLSNELRGKLEKSRPGTLAQAGRVDGM
TPAALALILARLRRGAMDSQGKTA