Protein Info for Psest_3520 in Pseudomonas stutzeri RCH2

Annotation: Short chain fatty acids transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 403 to 419 (17 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details PF02667: SCFA_trans" amino acids 1 to 445 (445 residues), 544 bits, see alignment E=3.3e-167 PF03806: ABG_transport" amino acids 294 to 408 (115 residues), 31.9 bits, see alignment E=4.7e-12

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 99% identity to psa:PST_0863)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRT2 at UniProt or InterPro

Protein Sequence (446 amino acids)

>Psest_3520 Short chain fatty acids transporter (Pseudomonas stutzeri RCH2)
MLNRITAASVYLVQRFLPSPFVFAILLTLIVLIAAMLSTGQGLPAMAQHWGNGFWNLLAF
TMQMSLILVTGHALARAPAINRLLDRMARIPQSPGQAIILVTLVALAGSWINWGFGLVIG
AVFARALARQVRGVDYPLLVASAYSGFLIWHGGFSGSIPLSLASGGADLEKMTGGALTEA
IGVGQTLFASYNLIIIAVLVVGLPLLNWAMQPKTPKVVDPALLEEPQPSDIPRETATQRL
DDSRILGLIMVALAVLFFYQHFSNNGLALSLNIVISIFLFAGLLMHGTPERYMRAIEESI
RGIAGIVVQFPFYAGIMGMMVGANAAGVSLGRQVTDTFIAWSSAESFPVLAFLSAGLVNV
FVPSGGGQWAVQGPIMLPAGAALGVAPEVTAMAIAWGDAWTNMIQPFWALPLLGIAGLGA
RDIMGYCLLCLVFSGVVIAGGLYFLT