Protein Info for PGA1_c35080 in Phaeobacter inhibens DSM 17395

Annotation: chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF10609: ParA" amino acids 8 to 170 (163 residues), 45.4 bits, see alignment E=2.5e-15 PF13614: AAA_31" amino acids 8 to 186 (179 residues), 214.5 bits, see alignment E=3.9e-67 PF09140: MipZ" amino acids 9 to 169 (161 residues), 40.7 bits, see alignment E=6.3e-14 PF06564: CBP_BcsQ" amino acids 9 to 255 (247 residues), 35.9 bits, see alignment E=2.1e-12 PF01656: CbiA" amino acids 10 to 237 (228 residues), 108.5 bits, see alignment E=7.8e-35 PF02374: ArsA_ATPase" amino acids 15 to 82 (68 residues), 30.6 bits, see alignment E=7.4e-11 PF00142: Fer4_NifH" amino acids 15 to 79 (65 residues), 31 bits, see alignment E=6.4e-11

Best Hits

Swiss-Prot: 52% identical to SOJ_BACHD: Sporulation initiation inhibitor protein Soj (soj) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 82% identity to sit:TM1040_2867)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5N0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PGA1_c35080 chromosome partitioning protein ParA (Phaeobacter inhibens DSM 17395)
MSRPAGPRIIAVANQKGGVGKTTTAINLAAALVETGYRVLVVDLDPQGNASTGLGIEATD
RTRTTYDLLVDDVGLNDVIRETEIEDLCIIPATIDLSSADIELFTNEKRSFLLHDALRQP
AMDDYDWDYVLIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGVSQLMLTIREVRQTA
NPNLRIEGIVLTMYDRRNNLSQQVEQDARGHLGELVFETKIPRNVRVSEAPSYALPVLNY
DTNSLGANAYRALAEELIARHQKLAA