Protein Info for PGA1_c35070 in Phaeobacter inhibens DSM 17395

Annotation: chromosome-partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 38 to 209 (172 residues), 202 bits, see alignment E=3.5e-64 PF02195: ParBc" amino acids 40 to 129 (90 residues), 104.9 bits, see alignment E=2.9e-34 PF17762: HTH_ParB" amino acids 179 to 227 (49 residues), 52.7 bits, see alignment 4.6e-18 PF23552: ParB_dimer" amino acids 246 to 295 (50 residues), 56.8 bits, see alignment 1.8e-19

Best Hits

Swiss-Prot: 57% identical to PARB_CAUVN: Chromosome-partitioning protein ParB (parB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 83% identity to sit:TM1040_2868)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ES08 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PGA1_c35070 chromosome-partitioning protein ParB (Phaeobacter inhibens DSM 17395)
MSEKKNKPRGLGRGLSALMADVNPEPVSTEKQAIRSTEVMVPIEKVIANPDQPRRQFLQE
DLDDLTASIREKGVLQPLIVRPRPGGQYEIVAGERRWRAAQGAQLHEVPVIIRDYSDVEM
MEVAIIENIQRSDLNAMEEAQSYKQLMDKFGHTQEKMAEALGKSRSHIANLVRLLHLPDD
VQSLVQERRLSAGHARALITSDNASDLAKKIVKGGLSVRATEALVKKDAAGLQVATARSA
KKTAEKDADTRALEADLSAALRMKVSIDHRAGGENGVLSISYTSLDELDDLCGRLSR