Protein Info for HP15_3394 in Marinobacter adhaerens HP15

Annotation: major facilitator superfamily MFS_1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF07690: MFS_1" amino acids 4 to 337 (334 residues), 84.5 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: None (inferred from 84% identity to maq:Maqu_3632)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF87 at UniProt or InterPro

Protein Sequence (383 amino acids)

>HP15_3394 major facilitator superfamily MFS_1 (Marinobacter adhaerens HP15)
MIVLAQLFGTSLWFSINGVWLSLAGELGLTESDLGRLTLAVQAGFIAGTLTIAVTGLADR
FGASRIFALSSLLGALVNGGFIFAAGAPPLDFLLRFATGLCLAGIYPLGMKMVIAWTPKY
AGAALAWLVGMLTLGTALPHLMRGATLGMPWEWPLMAASCLAVAGGLLVFLLGDGPHLPK
SSGRLPLSQGLAALRIPRFRAVAGGYFGHMWELYAFWTLTPLLIGRELQRMGQSDSLIPW
LSFAVIGIGAAGCVGGGRLSRTRGSEWVARRALMVSGAFCLVYPWLNGLSPALLIVLLIV
WGIAVVADSPQFSALASATAPRESVGSSLAVMNAVGFGLTLPAIWLTSGLWGQLNVWVVL
LLFPGPVLGLCALSRARPEVQAG