Protein Info for PGA1_c35030 in Phaeobacter inhibens DSM 17395

Annotation: ribonuclease PH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR01966: ribonuclease PH" amino acids 2 to 235 (234 residues), 360.2 bits, see alignment E=2e-112 PF01138: RNase_PH" amino acids 10 to 140 (131 residues), 98.6 bits, see alignment E=3.8e-32 PF03725: RNase_PH_C" amino acids 157 to 224 (68 residues), 51.2 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 92% identical to RNPH_RUEST: Ribonuclease PH (rph) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00989, ribonuclease PH [EC: 2.7.7.56] (inferred from 92% identity to sit:TM1040_2872)

Predicted SEED Role

"Ribonuclease PH (EC 2.7.7.56)" in subsystem Heat shock dnaK gene cluster extended or tRNA processing (EC 2.7.7.56)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5M5 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PGA1_c35030 ribonuclease PH (Phaeobacter inhibens DSM 17395)
MRPSGRDLNQMRAVSIETGFTKHAEGSCLIKMGDTHVLCTATIEDRVPPFIKGSGLGWVT
AEYGMLPRATNTRMRREAAMGKQGGRTVEIQRLIGRALRAGVDRVALGERQISIDCDVLQ
ADGGTRCASITGGWVALRLAVNKLMKTGEVKIDPLVDPVAAVSCGIYAGQPVLDLDYPED
SEAGVDGNFIMTGSGQLIEVQMSAEGSMFSREQMNTLMDLATKGTAELAELQKAACV