Protein Info for PGA1_c35000 in Phaeobacter inhibens DSM 17395

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 877 PF01624: MutS_I" amino acids 5 to 121 (117 residues), 142.6 bits, see alignment E=1.7e-45 TIGR01070: DNA mismatch repair protein MutS" amino acids 5 to 873 (869 residues), 875.5 bits, see alignment E=2.3e-267 PF05188: MutS_II" amino acids 130 to 257 (128 residues), 69.1 bits, see alignment E=1.6e-22 PF05192: MutS_III" amino acids 273 to 569 (297 residues), 145.3 bits, see alignment E=8.7e-46 PF05190: MutS_IV" amino acids 433 to 526 (94 residues), 84.7 bits, see alignment E=1.4e-27 PF00488: MutS_V" amino acids 626 to 813 (188 residues), 280.7 bits, see alignment E=2.1e-87 PF27441: MutS_C" amino acids 845 to 874 (30 residues), 54.1 bits, see alignment (E = 3.1e-18)

Best Hits

Swiss-Prot: 82% identical to MUTS_RUEST: DNA mismatch repair protein MutS (mutS) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 82% identity to sit:TM1040_2875)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVP8 at UniProt or InterPro

Protein Sequence (877 amino acids)

>PGA1_c35000 DNA mismatch repair protein MutS (Phaeobacter inhibens DSM 17395)
MSTVTPMMAQYLDIKAQYPDALLFYRMGDFYEMFFDDAVNAAEALDIALTKRGKHDGNDI
PMCGVPVHAAEGYLLTLIRKGFRVAVGEQLESPAEAKKRGSKSVVKRDVVRLVTPGTITE
DSLLEARRHNFLTAYCELRDQAALAWADISTGAFHVMPVASVRVSPELARLAPSELIVPD
GPALDQLRTIAEDHQIPVTPLAKSSFDSTAAEKRICDLFKVSTLESYGSFSRAEISAMGA
VIDYLDITQKGKLPLLQPPQQEAEDRVVQIDAATRRSLELTRALTGGRGGSLLAVVDRTV
TPAGGRLLEQRLSSPSRNLDVIRARLTALDFVVGQIQLAQSLRTALRKTPDLDRALSRLA
LDRGGPRDLAAVRNTLIQSEAISDLCDRADMPALLQQSLSGLTGFDDLLPLLDAALIAEP
PLLARDGGFIAEGYDSELDEARTLRDEGRSVIAALQKKYSDHTGINSLKIKHNNVLGYFI
ETTATHAEKMLSAPLSETYIHRQTTANQVRFTTVELSEIETRILNAGNLALEIEKRLYTR
LSDAILADAALLNAAARGLAELDLITALADLALGENWSCPTVDNSREFNISGGRHPVVEQ
ALRQQGGSSFVANDCDLTADTGAAIWLLTGPNMAGKSTFLRQNALIAILAQMGSYVPADS
AHIGLISQLFSRVGASDDLARGRSTFMVEMVETAAILNQADDRALVILDEIGRGTATYDG
LSIAWATLEHLHEVNRARALFATHYHELTQLAGKLPGVDNATVSVKEWKGEVIFLHEVKK
GAADRSYGVQVAQLAGLPGSVVARARDVLDMLEEGSRSGAGKIQIDDLPLFAAAPPPQAA
AAVGPSPIETLLNDIHPDDLSPREALEALYRLKEAAN