Protein Info for Psest_3511 in Pseudomonas stutzeri RCH2

Updated annotation (from data): Maleylacetoacetate isomerase (EC 5.2.1.2)
Rationale: Specifically important for utilizing L-tyrosine disodium salt. Automated validation from mutant phenotype: the predicted function (MALEYLACETOACETATE-ISOMERASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 4 to 83 (80 residues), 54.9 bits, E=1.4e-18
• TIGR01262: maleylacetoacetate isomerase
  • amino acids 6 to 218 (213 residues), 284.7 bits, E=2.2e-89
• PF13417: GST_N_3
  • amino acids 7 to 86 (80 residues), 50.8 bits, E=2.6e-17
• PF13409: GST_N_2
  • amino acids 13 to 83 (71 residues), 51.3 bits, E=2.2e-17

Best Hits

Swiss-Prot: 55% identical to MAAI_VIBCH: Probable maleylacetoacetate isomerase (maiA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 97% identity to psa:PST_0872)

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450
• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

See L0GRL5 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Psest_3511 Maleylacetoacetate isomerase (EC 5.2.1.2) (Pseudomonas stutzeri RCH2)
MGTELTLYGYWRSSAAYRVRIALNLKGLAYRQVPVHLVKDGGQQRAADYRALNPQQLVPL
LVDEGNGGARISQSLAILEYLDEVFPVPALLPADPVERAQVRSLAMHIACEIHPLNNLRV
LQYLSAELGVDDEAKNAWYRHWVSQGLAAVEQGLETFGDKLSLNDRPGYLEACLVPQVYN
ARRFACDLAAYPRILEIVARCETLPAFQQAAPEVQPDAQ