Protein Info for Psest_3505 in Pseudomonas stutzeri RCH2

Annotation: Superfamily II DNA and RNA helicases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF04851: ResIII" amino acids 23 to 190 (168 residues), 37.8 bits, see alignment E=2.9e-13 PF00270: DEAD" amino acids 25 to 194 (170 residues), 165.6 bits, see alignment E=1.3e-52 PF00271: Helicase_C" amino acids 231 to 339 (109 residues), 103.6 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 58% identical to RHLE_ECOLI: ATP-dependent RNA helicase RhlE (rhlE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to psa:PST_0878)

MetaCyc: 58% identical to ATP-dependent RNA helicase RhlE (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase PA3950" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRR7 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Psest_3505 Superfamily II DNA and RNA helicases (Pseudomonas stutzeri RCH2)
MTFASLGLIDPLLRTLETLDYRKPTPVQIEAIPAVLKGRDLMAAAQTGTGKTAGFALPLL
QRLTMEGAKVASNSVRALVLVPTRELAEQVHESFRVYGQNLPLRTYAVYGGVSINPQMMA
LRKGIDVLVATPGRLLDLYRQNAVGFNQLQALVLDEADRMLDLGFADELDQLFSALPKKR
QTLLFSATFSEAIRQMARELLRDPLSVEVSPRNAAAKTVKQWLVPVDKKRKSELFLHLLA
EKRWGQVLVFVKTRKGVDQLVDELQAAGISSDAIHGDKPQASRLRALERFKAGEVQVLVA
TDVAARGLDIHDLPQVVNFDLPIVAEDYVHRIGRTGRAGATGEAVSLVSADEVDQLAAIE
TLINQVLPRHDELGFVPDHRVPTTTLGGQIIKKPKKPKKPKDAGGKGKIHLGNWFDESEK
PNAKPIRKVPSLGGGKPAKKR