Protein Info for PGA1_c03550 in Phaeobacter inhibens DSM 17395

Annotation: dihydrolipoyl dehydrogenase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 3 to 464 (462 residues), 564.8 bits, E=6.9e-174
• PF07992: Pyr_redox_2
  • amino acids 4 to 326 (323 residues), 256.8 bits, E=1.7e-79
• PF12831: FAD_oxidored
  • amino acids 5 to 46 (42 residues), 35.8 bits, 3.7e-12
• PF00890: FAD_binding_2
  • amino acids 5 to 41 (37 residues), 31.4 bits, 7.4e-11
• PF01134: GIDA
  • amino acids 5 to 65 (61 residues), 32 bits, E=4.4e-11
• PF13738: Pyr_redox_3
  • amino acids 7 to 310 (304 residues), 48.9 bits, E=3.4e-16
• PF13450: NAD_binding_8
  • amino acids 8 to 44 (37 residues), 27.2 bits, 2.3e-09
• PF00070: Pyr_redox
  • amino acids 173 to 249 (77 residues), 77.4 bits, E=6.1e-25
• PF02852: Pyr_redox_dim
  • amino acids 345 to 455 (111 residues), 131.6 bits, E=8.4e-42

Best Hits

Swiss-Prot: 71% identical to DLDH_RHOCA: Dihydrolipoyl dehydrogenase (lpd) from Rhodobacter capsulatus

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 92% identity to sit:TM1040_3504)

MetaCyc: 53% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• photorespiration I (7/9 steps found)
• photorespiration III (7/9 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (2/3 steps found)
• photorespiration II (7/10 steps found)
• folate transformations I (9/13 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

See I7DXA4 at UniProt or InterPro

Protein Sequence (465 amino acids)

>PGA1_c03550 dihydrolipoyl dehydrogenase 2 (Phaeobacter inhibens DSM 17395)
MASYDVIVIGAGPGGYVCAIRCAQLGLKTAVVEGRETLGGTCLNVGCIPSKALLHSTHLL
HEAEHNFAHMGLKGKSPSVDWSQMKSYKEEVIGQNTGGIEFLFKKNKIDWIKGWASLSEA
GKVKVGDDTHEAKNIVIASGSVPSSLPGVEVDNDKGIVVDSTGALDLPKIPKKMVVIGAG
VIGLELGSVYARLGSDVTVVEYMDAVCPGMDKDVQRSFKRILEKQGLNFIMGAAVQEVET
SKTKAKVKYQPKKGGDEEVIDADVVLVATGRKPYAEGLGLDALGVKMTERGQIATDAHWA
TNVNGVYAIGDVIEGPMLAHKAEDEGMAVAEVIADKHGHVNYGVIPGVVYTTPEVATVGQ
TEDALKAEGRKIKTGKFMFMGNARAKAVHQAEGGFVKLIADKETDRILGAAIIGPGAGDL
IHEICVAMEFGASAEDLALTCHAHPTYSEAVREAALACGDGPIHS