Protein Info for PGA1_c34900 in Phaeobacter inhibens DSM 17395

Annotation: threonine dehydratase biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 82% identity to sit:TM1040_2885)

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (12/13 steps found)
superpathway of L-threonine metabolism (15/18 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-methionine degradation II (3/3 steps found)
L-threonine degradation I (5/6 steps found)
L-threonine degradation V (1/2 steps found)
hypoglycin biosynthesis (4/14 steps found)
cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVN5 at UniProt or InterPro

Protein Sequence (408 amino acids)

>PGA1_c34900 threonine dehydratase biosynthetic (Phaeobacter inhibens DSM 17395)
MSDFQTQARAAEQAMRAIFPATPLQRSALLSERFGAEIYLKREDLSPVRSYKIRGAFNAM
RKQLEQSLFVCASAGNHAQGVAYMCRELGKRGVIFMPVTTPQQKIQKTRMFGGDSVEIHL
VGDYFDDTLAAAQKWCADEGGHFLSPFDDDDVIEGQSSIAVEIEAQLGAAPDHVILPVGG
GGMSSGVARWFGDRVHCLFAEPSGGACLRAALAAGHPVALDHVDTFVDGAAVGRVGARPF
EVLKQVPLPDVLSIAEDRICTTILEMLNVEGVVLEPAGALAIEALRDVRSWIRGKTVVCL
TSGGNFDFERLPEVKERAQRYMGLKKYFLLRLPQRPGALKEFLGILGPEDDIARFEYMKK
SARNFGSVLIGIETKRPENFADLYARLDAAGFAYTDITSDETLAQFVI