Protein Info for Psest_3495 in Pseudomonas stutzeri RCH2

Annotation: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00027: cNMP_binding" amino acids 35 to 123 (89 residues), 67.7 bits, see alignment E=7.2e-23 PF13545: HTH_Crp_2" amino acids 156 to 222 (67 residues), 57.7 bits, see alignment E=9.3e-20

Best Hits

KEGG orthology group: None (inferred from 54% identity to psa:PST_0889)

Predicted SEED Role

"Nitric oxide -responding transcriptional regulator Dnr (Crp/Fnr family)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRR2 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psest_3495 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (Pseudomonas stutzeri RCH2)
MSKQSTHLAVLRNHPLFNGLPESALDELEQATCSRRLQAGQTLYYQGDSAQNFFILVHGQ
LKLHRHSSDGNEHVLGIVRPGGALGETLLYDRRPSHLLTATALRDSLVIQIHNASYRNLL
ERYPRLAPALLARLSERLNQRLEDIDNLATSSANHRVARFLMLRQKSNSGVVELDIPKRL
IASKLGIQPETLSRILHRLSDAGLISMQSRRIDILDQRKLAAFLHDSVDQRCHPMGTGSL
TTLRKAG